PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0063ss00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family B3
Protein Properties Length: 142aa    MW: 15950.5 Da    PI: 4.5959
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0063ss00050.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.26e-13571104094
                        ETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                 B3  40 desgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                        +  g+sW++ ++ ++k  +++ ++GWk+F+ +n L++gD ++F+l+++s+++  +
  Vang0063ss00050.1  57 TYMGKSWDMVYCGQNKL-QVFSAAGWKKFAVENCLRVGDACIFELMESSDKKVIF 110
                        5579*******655554.577889*********************9887776554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.47E-1253116IPR015300DNA-binding pseudobarrel domain
PfamPF023621.9E-1055110IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-1158116IPR015300DNA-binding pseudobarrel domain
CDDcd100178.90E-1160116No hitNo description
PROSITE profilePS5086310.78560118IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MSSRRSNGRV ASGRDALENE VPLPPLPDPT TNLQWGEWPA ISVRLELPFC EVPTILTYMG  60
KSWDMVYCGQ NKLQVFSAAG WKKFAVENCL RVGDACIFEL MESSDKKVIF EVQILRGDIP  120
YEILKNEMIM GQNPEMPIVL N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-177AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014508354.11e-87PREDICTED: B3 domain-containing protein Os06g0112300-like
TrEMBLV7CHZ02e-76V7CHZ0_PHAVU; Uncharacterized protein
STRINGGLYMA07G35040.23e-59(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97222640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G33280.18e-07B3 family protein